Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | IHC,WB-Ce,IF |
Brand: | Abnova |
Reference: | PAB28707 |
Product name: | MED15 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant MED15. |
Isotype: | IgG |
Gene id: | 51586 |
Gene name: | MED15 |
Gene alias: | ARC105|CAG7A|CTG7A|DKFZp686A2214|DKFZp762B1216|FLJ42282|FLJ42935|PCQAP|TIG-1|TIG1|TNRC7 |
Gene description: | mediator complex subunit 15 |
Immunogen: | Recombinant protein corresponding to amino acids of human MED15. |
Immunogen sequence/protein sequence: | QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:10-1:20) Immunofluorescence (1-4 ug/ml) Western Blot (1:100-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human placenta with MED15 polyclonal antibody (Cat # PAB28707) shows strong nuclear and cytoplasmic positivity in trophoblastic cells at 1:10-1:20 dilution. |
Applications: | IHC,WB-Ce,IF |
Shipping condition: | Dry Ice |