S100A12 polyclonal antibody View larger

S100A12 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of S100A12 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,IF,WB-Tr

More info about S100A12 polyclonal antibody

Brand: Abnova
Reference: PAB28697
Product name: S100A12 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant S100A12.
Isotype: IgG
Gene id: 6283
Gene name: S100A12
Gene alias: CAAF1|CAGC|CGRP|ENRAGE|MRP6|p6
Gene description: S100 calcium binding protein A12
Immunogen: Recombinant protein corresponding to amino acids of human S100A12.
Immunogen sequence/protein sequence: KLEEHLEGIVNIFHQYSVRKGHFDTLSKGELKQLLTKELANTIKNIKDKAVIDEIFQGLDANQDEQVDFQEFISLVAIALKAAHYHTHKE
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28697-51-89-1.jpg
Application image note: Western blot anyalysis of Lane 1: Negative control (vector only transfected HEK293T lysate), Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401723) with S100A12 polyclonal antibody (Cat # PAB28697) at 1:100-1:250 dilution.
Applications: IHC,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy S100A12 polyclonal antibody now

Add to cart