RPS6KA6 polyclonal antibody View larger

RPS6KA6 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPS6KA6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,IF

More info about RPS6KA6 polyclonal antibody

Brand: Abnova
Reference: PAB28694
Product name: RPS6KA6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RPS6KA6.
Isotype: IgG
Gene id: 27330
Gene name: RPS6KA6
Gene alias: RSK4
Gene description: ribosomal protein S6 kinase, 90kDa, polypeptide 6
Immunogen: Recombinant protein corresponding to amino acids of human RPS6KA6.
Immunogen sequence/protein sequence: PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28694-32-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with RPS6KA6 polyclonal antibody (Cat # PAB28694) shows strong cytoplasmic and membranous positivity in glandular cells.
Applications: IHC,IF
Shipping condition: Dry Ice

Reviews

Buy RPS6KA6 polyclonal antibody now

Add to cart