ZNF175 polyclonal antibody View larger

ZNF175 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF175 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC,IF

More info about ZNF175 polyclonal antibody

Brand: Abnova
Reference: PAB28682
Product name: ZNF175 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZNF175.
Isotype: IgG
Gene id: 7728
Gene name: ZNF175
Gene alias: OTK18
Gene description: zinc finger protein 175
Immunogen: Recombinant protein corresponding to amino acids of human ZNF175.
Immunogen sequence/protein sequence: QNQIQPMSHSAFFNKKTLNTESNCEYKDPGKMIRTRPHLASSQKQPQKCCLFTESLKLNLEVNGQNESNDTEQLDDVVGSGQLFSHSSSDACSKNIHTGETFCKGNQCRKVCGHKQSLKQHQ
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28682-32-3-1.jpg
Application image note: Immunohistochemical staining of human heart muscle with ZNF175 polyclonal antibody (Cat # PAB28682) shows strong cytoplasmic positivity in myocytes .
Applications: IHC,IF
Shipping condition: Dry Ice

Reviews

Buy ZNF175 polyclonal antibody now

Add to cart