Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC |
Brand: | Abnova |
Reference: | PAB28675 |
Product name: | RNASEL polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant RNASEL. |
Isotype: | IgG |
Gene id: | 6041 |
Gene name: | RNASEL |
Gene alias: | DKFZp781D08126|MGC104972|MGC133329|PRCA1|RNS4 |
Gene description: | ribonuclease L (2',5'-oligoisoadenylate synthetase-dependent) |
Immunogen: | Recombinant protein corresponding to amino acids of human RNASEL. |
Immunogen sequence/protein sequence: | HGAKEDFHPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSI |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry Western Blot The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western blot analysis of Lane 1: Human cell line RT-4, Lane 2: Human cell line U-251MG sp with RNASEL polyclonal antibody (Cat # PAB28675). |
Applications: | WB,IHC |
Shipping condition: | Dry Ice |