Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | IHC,WB-Ce |
Brand: | Abnova |
Reference: | PAB28673 |
Product name: | ERH polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant ERH. |
Isotype: | IgG |
Gene id: | 2079 |
Gene name: | ERH |
Gene alias: | DROER|FLJ27340 |
Gene description: | enhancer of rudimentary homolog (Drosophila) |
Immunogen: | Recombinant protein corresponding to amino acids of human ERH. |
Immunogen sequence/protein sequence: | LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:200-1:500) Western Blot (1:100-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Western blot anyalysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with ERH polyclonal antibody (Cat # PAB28673) at 1:100-1:500 dilution. |
Applications: | IHC,WB-Ce |
Shipping condition: | Dry Ice |