SLMAP polyclonal antibody View larger

SLMAP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLMAP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC

More info about SLMAP polyclonal antibody

Brand: Abnova
Reference: PAB28662
Product name: SLMAP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLMAP.
Isotype: IgG
Gene id: 7871
Gene name: SLMAP
Gene alias: FLJ42206|KIAA1601|MGC138760|MGC138761|SLAP
Gene description: sarcolemma associated protein
Immunogen: Recombinant protein corresponding to amino acids of human SLMAP.
Immunogen sequence/protein sequence: SEYEKEITSLQNSFQLRCQQCEDQQREEATRLQGELEKLRKEWNALETECHSLKRENVLLSSELQRQEKELHNSQKQSLELTSDLSILQMSRKELENQVGSLKEQHLRDSADLKTLLSKAENQAKDVQKEYEKTQTVLSELKLKFEMTEQ
Form: liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28662-32-44-1.jpg
Application image note: Immunohistochemical staining of human smooth muscle with SLMAP polyclonal antibody (Cat # PAB28662) shows strong cytoplasmic positivity in smooth muscle cells.
Applications: WB,IHC
Shipping condition: Dry Ice

Reviews

Buy SLMAP polyclonal antibody now

Add to cart