PPFIBP2 polyclonal antibody View larger

PPFIBP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPFIBP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about PPFIBP2 polyclonal antibody

Brand: Abnova
Reference: PAB28658
Product name: PPFIBP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PPFIBP2.
Isotype: IgG
Gene id: 8495
Gene name: PPFIBP2
Gene alias: Cclp1|DKFZp781K06126|MGC42541
Gene description: PTPRF interacting protein, binding protein 2 (liprin beta 2)
Immunogen: Recombinant protein corresponding to amino acids of human PPFIBP2.
Immunogen sequence/protein sequence: SGATPNGEAAKSPPTICQPDATGSSLLRLRDTESGWDDTAVVNDLSSTSSGTESGPQSPLTPDGKRNPKGIKKFWGKIRRTQSGNFYTDTLGMAEFRRGGL
Form: liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28658-49-224-1.jpg
Application image note: Immunofluorescent staining of human cell line U373 MG with PPFIBP2 polyclonal antibody (Cat # PAB28658) at 1-4 ug/mL shows positivity in mitochondria.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PPFIBP2 polyclonal antibody now

Add to cart