ABL2 polyclonal antibody View larger

ABL2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABL2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about ABL2 polyclonal antibody

Brand: Abnova
Reference: PAB28653
Product name: ABL2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ABL2.
Isotype: IgG
Gene id: 27
Gene name: ABL2
Gene alias: ABLL|ARG|FLJ22224|FLJ31718|FLJ41441
Gene description: v-abl Abelson murine leukemia viral oncogene homolog 2 (arg, Abelson-related gene)
Immunogen: Recombinant protein corresponding to amino acids of human ABL2.
Immunogen sequence/protein sequence: MAGVPEDGEQPGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKA
Form: liquid
Recommend dilutions: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:10-1:20)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28653-49-4-1.jpg
Application image note: Immunofluorescent staining of human cell line A-431 with ABL2 polyclonal antibody (Cat # PAB28653) at 1-4 ug/mL shows positivity in nucleus.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ABL2 polyclonal antibody now

Add to cart