RAB9A polyclonal antibody View larger

RAB9A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB9A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P

More info about RAB9A polyclonal antibody

Brand: Abnova
Reference: PAB28649
Product name: RAB9A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RAB9A.
Isotype: IgG
Gene id: 9367
Gene name: RAB9A
Gene alias: RAB9
Gene description: RAB9A, member RAS oncogene family
Immunogen: Recombinant protein corresponding to amino acids of human RAB9A.
Immunogen sequence/protein sequence: SDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPYFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKP
Protein accession: P51151
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28649-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with RAB9A polyclonal antibody (Cat # PAB28649) shows strong cytoplasmic positivity in glandular cells.
Applications: WB,WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy RAB9A polyclonal antibody now

Add to cart