CSDC2 polyclonal antibody View larger

CSDC2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CSDC2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about CSDC2 polyclonal antibody

Brand: Abnova
Reference: PAB28647
Product name: CSDC2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CSDC2.
Isotype: IgG
Gene id: 27254
Gene name: CSDC2
Gene alias: PIPPIN|dJ347H13.2
Gene description: cold shock domain containing C2, RNA binding
Immunogen: Recombinant protein corresponding to amino acids of human CSDC2.
Immunogen sequence/protein sequence: PTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQ
Protein accession: Q9Y534
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28647-48-38-1.jpg
Application image note: Immunohistochemical staining of human pancreas with CSDC2 polyclonal antibody (Cat # PAB28647) shows strong nuclear positivity in both exocrine glandular cells and Islet cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CSDC2 polyclonal antibody now

Add to cart