TST polyclonal antibody View larger

TST polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TST polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about TST polyclonal antibody

Brand: Abnova
Reference: PAB28638
Product name: TST polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TST.
Isotype: IgG
Gene id: 7263
Gene name: TST
Gene alias: MGC19578|RDS
Gene description: thiosulfate sulfurtransferase (rhodanese)
Immunogen: Recombinant protein corresponding to amino acids of human TST.
Immunogen sequence/protein sequence: RSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKS
Protein accession: Q16762
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28638-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with TST polyclonal antibody (Cat # PAB28638) shows strong cytoplasmic positivity, with a granular pattern, in glandular cells at 1:1000-1:2500 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TST polyclonal antibody now

Add to cart