VPREB3 polyclonal antibody View larger

VPREB3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VPREB3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about VPREB3 polyclonal antibody

Brand: Abnova
Reference: PAB28637
Product name: VPREB3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant VPREB3.
Isotype: IgG
Gene id: 29802
Gene name: VPREB3
Gene alias: 8HS20|N27C7-2
Gene description: pre-B lymphocyte 3
Immunogen: Recombinant protein corresponding to amino acids of human VPREB3.
Immunogen sequence/protein sequence: QLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP
Protein accession: Q9UKI3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28637-48-10-1.jpg
Application image note: Immunohistochemical staining of human lymph node with VPREB3 polyclonal antibody (Cat # PAB28637) shows strong cytoplasmic positivity in reaction center cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VPREB3 polyclonal antibody now

Add to cart