DLST polyclonal antibody View larger

DLST polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLST polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P

More info about DLST polyclonal antibody

Brand: Abnova
Reference: PAB28629
Product name: DLST polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DLST.
Isotype: IgG
Gene id: 1743
Gene name: DLST
Gene alias: DLTS
Gene description: dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Immunogen: Recombinant protein corresponding to amino acids of human DLST.
Immunogen sequence/protein sequence: QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII
Protein accession: B7Z5W8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28629-48-8-1.jpg
Application image note: Immunohistochemical staining of human liver with DLST polyclonal antibody (Cat # PAB28629) shows strong cytoplasmic positivity in hepatocytes.
Applications: WB,WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy DLST polyclonal antibody now

Add to cart