CTSS polyclonal antibody View larger

CTSS polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CTSS polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about CTSS polyclonal antibody

Brand: Abnova
Reference: PAB28624
Product name: CTSS polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CTSS.
Isotype: IgG
Gene id: 1520
Gene name: CTSS
Gene alias: MGC3886
Gene description: cathepsin S
Immunogen: Recombinant protein corresponding to amino acids of human CTSS.
Immunogen sequence/protein sequence: NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCG
Protein accession: P25774
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28624-48-9-1.jpg
Application image note: Immunohistochemical staining of human spleen with CTSS polyclonal antibody (Cat # PAB28624) shows strong cytoplasmic positivity in cells in red pulp at 1:200-1:500 dilution.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy CTSS polyclonal antibody now

Add to cart