CADM3 polyclonal antibody View larger

CADM3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CADM3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about CADM3 polyclonal antibody

Brand: Abnova
Reference: PAB28623
Product name: CADM3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CADM3.
Isotype: IgG
Gene id: 57863
Gene name: CADM3
Gene alias: BIgR|FLJ10698|IGSF4B|NECL1|Necl-1|TSLL1|synCAM3
Gene description: cell adhesion molecule 3
Immunogen: Recombinant protein corresponding to amino acids of human CADM3.
Immunogen sequence/protein sequence: QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
Protein accession: Q8N126
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28623-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with CADM3 polyclonal antibody (Cat # PAB28623) shows strong positivity in neuropil.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CADM3 polyclonal antibody now

Add to cart