SKAP1 polyclonal antibody View larger

SKAP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SKAP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about SKAP1 polyclonal antibody

Brand: Abnova
Reference: PAB28622
Product name: SKAP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SKAP1.
Isotype: IgG
Gene id: 8631
Gene name: SKAP1
Gene alias: SCAP1|SKAP55
Gene description: src kinase associated phosphoprotein 1
Immunogen: Recombinant protein corresponding to amino acids of human SKAP1.
Immunogen sequence/protein sequence: SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28622-48-10-1.jpg
Application image note: Immunohistochemical staining of human lymph node with SKAP1 polyclonal antibody (Cat # PAB28622) shows moderate cytoplasmic positivity.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SKAP1 polyclonal antibody now

Add to cart