PSMD10 polyclonal antibody View larger

PSMD10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSMD10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P,IF

More info about PSMD10 polyclonal antibody

Brand: Abnova
Reference: PAB28611
Product name: PSMD10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PSMD10.
Isotype: IgG
Gene id: 5716
Gene name: PSMD10
Gene alias: dJ889N15.2|p28
Gene description: proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
Immunogen: Recombinant protein corresponding to amino acids of human PSMD10.
Immunogen sequence/protein sequence: EGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPL
Protein accession: O75832
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28611-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with PSMD10 polyclonal antibody (Cat # PAB28611) shows moderate cytoplasmic and nuclear positivity in cells of seminiferus ducts at 1:500-1:1000 dilution.
Applications: WB,WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PSMD10 polyclonal antibody now

Add to cart