APEX1 polyclonal antibody View larger

APEX1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APEX1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about APEX1 polyclonal antibody

Brand: Abnova
Reference: PAB28591
Product name: APEX1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant APEX1.
Isotype: IgG
Gene id: 328
Gene name: APEX1
Gene alias: APE|APE-1|APE1|APEN|APEX|APX|HAP1|REF-1|REF1
Gene description: APEX nuclease (multifunctional DNA repair enzyme) 1
Immunogen: Recombinant protein corresponding to amino acids of human APEX1.
Immunogen sequence/protein sequence: KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD
Protein accession: G3V3M6
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28591-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with APEX1 polyclonal antibody (Cat#PAB28591) at 4 ug/ml shows positivity in nucleus.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy APEX1 polyclonal antibody now

Add to cart