DDX24 polyclonal antibody View larger

DDX24 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DDX24 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about DDX24 polyclonal antibody

Brand: Abnova
Reference: PAB28588
Product name: DDX24 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DDX24.
Isotype: IgG
Gene id: 57062
Gene name: DDX24
Gene alias: -
Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 24
Immunogen: Recombinant protein corresponding to amino acids of human DDX24.
Immunogen sequence/protein sequence: FPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKE
Protein accession: F5GYL3
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28588-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with DDX24 polyclonal antibody (Cat#PAB28588) at 4 ug/ml shows positivity in nucleoli and cytoplasm.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy DDX24 polyclonal antibody now

Add to cart