FMNL3 polyclonal antibody View larger

FMNL3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FMNL3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FMNL3 polyclonal antibody

Brand: Abnova
Reference: PAB28587
Product name: FMNL3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FMNL3.
Isotype: IgG
Gene id: 91010
Gene name: FMNL3
Gene alias: DKFZp762B245|FHOD3|FLJ45265|MGC45819|WBP3
Gene description: formin-like 3
Immunogen: Recombinant protein corresponding to amino acids of human FMNL3.
Immunogen sequence/protein sequence: LLDVKELGRGMELIRRECSIHDNSVLRNFLSTNEGKLDKLQRDAKTAEEAYNAVVRYFGESPKTTPPSVFFPVFVRFIRSYKEAEQENEARKKQEEVMREKQLAQEAKKLDAKTPSQRNKWQQQE
Protein accession: Q8IVF7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28587-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with FMNL3 polyclonal antibody (Cat#PAB28587) shows moderate granular cytoplasmic positivity in cells of tubules at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FMNL3 polyclonal antibody now

Add to cart