Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LONP1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Rabbit |
| Applications | WB,WB-Ce,IHC-P |
More info about LONP1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB28578 |
| Product name: | LONP1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant LONP1. |
| Isotype: | IgG |
| Gene id: | 9361 |
| Gene name: | LONP1 |
| Gene alias: | LON|LONP|LonHS|MGC1498|PIM1|PRSS15|hLON |
| Gene description: | lon peptidase 1, mitochondrial |
| Immunogen: | Recombinant protein corresponding to human LONP1. |
| Immunogen sequence/protein sequence: | VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP |
| Form: | Liquid |
| Recommend dilutions: | Western Blot (Human: 1:100-1:250, Mouse/Rat: 1:100-1:500 Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human duodenum with LONP1 polyclonal antibody (Cat # PAB28578) shows strong cytoplasmic positivity in glandular cells. Retrieval method: HIER pH6 |
| Applications: | WB,WB-Ce,IHC-P |
| Shipping condition: | Dry Ice |