Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB,WB-Ce,IHC-P |
Brand: | Abnova |
Reference: | PAB28578 |
Product name: | LONP1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant LONP1. |
Isotype: | IgG |
Gene id: | 9361 |
Gene name: | LONP1 |
Gene alias: | LON|LONP|LonHS|MGC1498|PIM1|PRSS15|hLON |
Gene description: | lon peptidase 1, mitochondrial |
Immunogen: | Recombinant protein corresponding to human LONP1. |
Immunogen sequence/protein sequence: | VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP |
Form: | Liquid |
Recommend dilutions: | Western Blot (Human: 1:100-1:250, Mouse/Rat: 1:100-1:500 Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human duodenum with LONP1 polyclonal antibody (Cat # PAB28578) shows strong cytoplasmic positivity in glandular cells. Retrieval method: HIER pH6 |
Applications: | WB,WB-Ce,IHC-P |
Shipping condition: | Dry Ice |