IFI16 polyclonal antibody View larger

IFI16 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IFI16 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about IFI16 polyclonal antibody

Brand: Abnova
Reference: PAB28576
Product name: IFI16 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant IFI16.
Isotype: IgG
Gene id: 3428
Gene name: IFI16
Gene alias: IFNGIP1|MGC9466|PYHIN2
Gene description: interferon, gamma-inducible protein 16
Immunogen: Recombinant protein corresponding to human IFI16.
Immunogen sequence/protein sequence: KEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIK
Protein accession: E7EPR3
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28576-48-72-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human skin with IFI16 polyclonal antibody (Cat # PAB28576) shows strong nuclear positivity in epidermal cells. Retrieval method: HIER pH6
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IFI16 polyclonal antibody now

Add to cart