Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KDM6A polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about KDM6A polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB28570 |
| Product name: | KDM6A polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant KDM6A. |
| Isotype: | IgG |
| Gene id: | 7403 |
| Gene name: | KDM6A |
| Gene alias: | UTX|KABUK2|bA386N14.2 |
| Gene description: | lysine (K)-specific demethylase 6A |
| Immunogen: | Recombinant protein corresponding to human KDM6A. |
| Immunogen sequence/protein sequence: | IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT |
| Protein accession: | F5H5V6 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human duodenum with KDM6A polyclonal antibody (Cat # PAB28570) shows strong nuclear positivity in glandular cells. Retrieval method: HIER pH6 |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |