SULT1B1 polyclonal antibody View larger

SULT1B1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SULT1B1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about SULT1B1 polyclonal antibody

Brand: Abnova
Reference: PAB28569
Product name: SULT1B1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SULT1B1.
Isotype: IgG
Gene id: 27284
Gene name: SULT1B1
Gene alias: MGC13356|ST1B2|SULT1B2
Gene description: sulfotransferase family, cytosolic, 1B, member 1
Immunogen: Recombinant protein corresponding to human SULT1B1.
Immunogen sequence/protein sequence: KIEQFHSRPDDIVIATYPKSGTTWVSEIIDMILNDGDIEKCKRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFWENNCKMIYLARN
Protein accession: D6RD70
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28569-48-9-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human spleen with SULT1B1 polyclonal antibody (Cat # PAB28569) shows strong cytoplasmic positivity in cells in red pulp. Retrieval method: HIER pH6
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy SULT1B1 polyclonal antibody now

Add to cart