BTG2 polyclonal antibody View larger

BTG2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BTG2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about BTG2 polyclonal antibody

Brand: Abnova
Reference: PAB28556
Product name: BTG2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant BTG2.
Isotype: IgG
Gene id: 7832
Gene name: BTG2
Gene alias: MGC126063|MGC126064|PC3|TIS21
Gene description: BTG family, member 2
Immunogen: Recombinant protein corresponding to amino acids of recombinant BTG2.
Immunogen sequence/protein sequence: QEALTEHYKHHWFPEKPSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLG
Protein accession: P78543
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:200-1:500)
Western Blot(1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28556-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with BTG2 polyclonal antibody (Cat # PAB28556) shows strong cytoplasmic positivity in purkinje cells at 1:200-1:500 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy BTG2 polyclonal antibody now

Add to cart