Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,WB-Tr |
Brand: | Abnova |
Reference: | PAB28554 |
Product name: | C1QA polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant C1QA. |
Isotype: | IgG |
Gene id: | 712 |
Gene name: | C1QA |
Gene alias: | - |
Gene description: | complement component 1, q subcomponent, A chain |
Immunogen: | Recombinant protein corresponding to amino acids of recombinant C1QA. |
Immunogen sequence/protein sequence: | GSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFS |
Protein accession: | P02745 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry(-) Western Blot(-) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human lung with C1QA polyclonal antibody (Cat # PAB28554) shows strong cytoplasmic positivity in macrophages. |
Applications: | IHC-P,WB-Tr |
Shipping condition: | Dry Ice |