MVP polyclonal antibody View larger

MVP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MVP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about MVP polyclonal antibody

Brand: Abnova
Reference: PAB28550
Product name: MVP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MVP.
Isotype: IgG
Gene id: 9961
Gene name: MVP
Gene alias: LRP|VAULT1
Gene description: major vault protein
Immunogen: Recombinant protein corresponding to amino acids of recombinant MVP.
Immunogen sequence/protein sequence: VFEEVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHNYCVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLS
Protein accession: Q14764
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:200-1:500)
Western Blot(1:250-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28550-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with MVP polyclonal antibody (Cat # PAB28550) shows strong cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MVP polyclonal antibody now

Add to cart