PLSCR4 polyclonal antibody View larger

PLSCR4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PLSCR4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about PLSCR4 polyclonal antibody

Brand: Abnova
Reference: PAB28547
Product name: PLSCR4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PLSCR4.
Isotype: IgG
Gene id: 57088
Gene name: PLSCR4
Gene alias: TRA1
Gene description: phospholipid scramblase 4
Immunogen: Recombinant protein corresponding to amino acids of recombinant PLSCR4.
Immunogen sequence/protein sequence: PQQPSTFPLYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETNNRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSA
Protein accession: C9J6E1
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:20-1:50)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28547-48-47-1.jpg
Application image note: Immunohistochemical staining of human adrenal gland with PLSCR4 polyclonal antibody (Cat # PAB28547) shows strong cytoplasmic and membranous positivity in cortical cells at 1:20-1:50 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy PLSCR4 polyclonal antibody now

Add to cart