TAF7L polyclonal antibody View larger

TAF7L polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAF7L polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about TAF7L polyclonal antibody

Brand: Abnova
Reference: PAB28528
Product name: TAF7L polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TAF7L.
Isotype: IgG
Gene id: 54457
Gene name: TAF7L
Gene alias: FLJ23157|TAF2Q|dJ738A13.1
Gene description: TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa
Immunogen: Recombinant protein corresponding to amino acids of human TAF7L.
Immunogen sequence/protein sequence: ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRK
Protein accession: Q5H9L4
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/ml)
Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28528-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with TAF7L polyclonal antibody (Cat # PAB28528) shows cytoplasmic and nuclear positivity in cells of seminiferus ducts.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TAF7L polyclonal antibody now

Add to cart