Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P,IF |
Brand: | Abnova |
Reference: | PAB28500 |
Product name: | VAV1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant VAV1 |
Isotype: | IgG |
Gene id: | 7409 |
Gene name: | VAV1 |
Gene alias: | VAV |
Gene description: | vav 1 guanine nucleotide exchange factor |
Immunogen: | Recombinant protein corresponding to amino acids of human VAV1 |
Immunogen sequence/protein sequence: | LSWTPIAQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRSEPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHTHFLKEMKEAL |
Protein accession: | P15498 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry(1:20-1:50) Immunofluorescence(1-4 ug/ml) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescent staining of human cell line U-251MG with VAV1 polyclonal antibody (Cat # PAB28500) at 1-4 ug/ml shows positivity in cytoplasm & vesicles. |
Applications: | IHC-P,IF |
Shipping condition: | Dry Ice |