SHC1 polyclonal antibody View larger

SHC1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SHC1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SHC1 polyclonal antibody

Brand: Abnova
Reference: PAB28492
Product name: SHC1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SHC1
Isotype: IgG
Gene id: 6464
Gene name: SHC1
Gene alias: FLJ26504|SHC|SHCA
Gene description: SHC (Src homology 2 domain containing) transforming protein 1
Immunogen: Recombinant protein corresponding to amino acids of human SHC1
Immunogen sequence/protein sequence: PLRNESLSSLEEGASGSTPPEELPSPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLRLANPAGGRPGSKGEPGRAADDGEGIVGAAMPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMG
Protein accession: P29353
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28492-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with SHC1 polyclonal antibody (Cat # PAB28492) shows cytoplasmic positivity in trophoblastic cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SHC1 polyclonal antibody now

Add to cart