TJP2 polyclonal antibody View larger

TJP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TJP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P,IF

More info about TJP2 polyclonal antibody

Brand: Abnova
Reference: PAB28487
Product name: TJP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TJP2
Isotype: IgG
Gene id: 9414
Gene name: TJP2
Gene alias: MGC26306|X104|ZO-2|ZO2
Gene description: tight junction protein 2 (zona occludens 2)
Immunogen: Recombinant protein corresponding to amino acids of human TJP2
Immunogen sequence/protein sequence: IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG
Protein accession: F5H301
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28487-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: A-431, Lane 4: Liver, Lane 5: Tonsil with TJP2 polyclonal antibody at 1:100-1:250 dilution.
Applications: WB,WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy TJP2 polyclonal antibody now

Add to cart