DLG3 polyclonal antibody View larger

DLG3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DLG3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about DLG3 polyclonal antibody

Brand: Abnova
Reference: PAB28478
Product name: DLG3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DLG3
Isotype: IgG
Gene id: 1741
Gene name: DLG3
Gene alias: KIAA1232|MRX|MRX90|NE-Dlg|NEDLG|SAP-102|SAP102
Gene description: discs, large homolog 3 (Drosophila)
Immunogen: Recombinant protein corresponding to amino acids of human DLG3
Immunogen sequence/protein sequence: HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD
Protein accession: Q92796
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28478-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with DLG3 polyclonal antibody (Cat # PAB28478) at 1-4 ug/ml shows positivity in nucleus & nucleoli.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DLG3 polyclonal antibody now

Add to cart