KNG1 polyclonal antibody View larger

KNG1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KNG1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about KNG1 polyclonal antibody

Brand: Abnova
Reference: PAB28471
Product name: KNG1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KNG1
Isotype: IgG
Gene id: 3827
Gene name: KNG1
Gene alias: BDK|KNG
Gene description: kininogen 1
Immunogen: Recombinant protein corresponding to amino acids of human KNG1
Immunogen sequence/protein sequence: LFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKIDNVKKARVQVVAGKKYFIDFVARETTCSKESNEELTESCETK
Protein accession: P01042
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:50-1:200)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28471-48-2-1.jpg
Application image note: Immunohistochemical staining of human kidney with KNG1 polyclonal antibody (Cat # PAB28471) shows distinct membranous positivity in cells in tubules.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy KNG1 polyclonal antibody now

Add to cart