MYH9 polyclonal antibody View larger

MYH9 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYH9 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about MYH9 polyclonal antibody

Brand: Abnova
Reference: PAB28470
Product name: MYH9 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MYH9
Isotype: IgG
Gene id: 4627
Gene name: MYH9
Gene alias: DFNA17|EPSTS|FTNS|MGC104539|MHA|NMHC-II-A|NMMHCA
Gene description: myosin, heavy chain 9, non-muscle
Immunogen: Recombinant protein corresponding to amino acids of human MYH9
Immunogen sequence/protein sequence: REQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEELAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVKFNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDF
Protein accession: P35579
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:1000-1:2500)
Immunofluorescence(1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28470-49-224-1.jpg
Application image note: Immunofluorescent staining of human cell line U-251MG with MYH9 polyclonal antibody (Cat # PAB28470) at 1-4 ug/ml shows positivity in plasma membrane, cytoplasm & cytoskeleton (actin filaments).
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy MYH9 polyclonal antibody now

Add to cart