RBP4 polyclonal antibody View larger

RBP4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBP4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about RBP4 polyclonal antibody

Brand: Abnova
Reference: PAB28469
Product name: RBP4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant RBP4
Isotype: IgG
Gene id: 5950
Gene name: RBP4
Gene alias: -
Gene description: retinol binding protein 4, plasma
Immunogen: Recombinant protein corresponding to amino acids of human RBP4
Immunogen sequence/protein sequence: VKENFDKARFSGTWYAMAKKDPEGLFLQDNIVAEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGNDDHWIVDTDYDTYAVQYSCRLLNLDGTCA
Protein accession: P02753
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:20-1:50)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28469-48-8-1.jpg
Application image note: Immunohistochemical staining of human liver with RBP4 polyclonal antibody (Cat # PAB28469) shows distinct cytoplasmic positivity in hepatocytes.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy RBP4 polyclonal antibody now

Add to cart