MASP1 polyclonal antibody View larger

MASP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MASP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about MASP1 polyclonal antibody

Brand: Abnova
Reference: PAB28463
Product name: MASP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MASP1
Isotype: IgG
Gene id: 5648
Gene name: MASP1
Gene alias: CRARF|CRARF1|DKFZp686I01199|FLJ26383|MASP|MGC126283|MGC126284|PRSS5|RaRF
Gene description: mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor)
Immunogen: Recombinant protein corresponding to amino acids of human MASP1
Immunogen sequence/protein sequence: PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT
Protein accession: F8W876
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28463-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with MASP1 polyclonal antibody (Cat # PAB28463) shows distinct positivity in plasma at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy MASP1 polyclonal antibody now

Add to cart