Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB28463 |
Product name: | MASP1 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant MASP1 |
Isotype: | IgG |
Gene id: | 5648 |
Gene name: | MASP1 |
Gene alias: | CRARF|CRARF1|DKFZp686I01199|FLJ26383|MASP|MGC126283|MGC126284|PRSS5|RaRF |
Gene description: | mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) |
Immunogen: | Recombinant protein corresponding to amino acids of human MASP1 |
Immunogen sequence/protein sequence: | PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPT |
Protein accession: | F8W876 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry(1:20-1:50) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human stomach with MASP1 polyclonal antibody (Cat # PAB28463) shows distinct positivity in plasma at 1:20-1:50 dilution. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |