ELK3 polyclonal antibody View larger

ELK3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ELK3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF,WB-Tr

More info about ELK3 polyclonal antibody

Brand: Abnova
Reference: PAB28457
Product name: ELK3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ELK3.
Isotype: IgG
Gene id: 2004
Gene name: ELK3
Gene alias: ERP|NET|SAP2
Gene description: ELK3, ETS-domain protein (SRF accessory protein 2)
Immunogen: Recombinant protein corresponding to amino acids of recombinant ELK3.
Immunogen sequence/protein sequence: KNIIKKVIGQKFVYKFVSFPEILKMDPHAVEISRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTR
Protein accession: P41970
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:500-1:1000)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28457-48-220-1.jpg
Application image note: Immunohistochemical staining of human appendix with ELK3 polyclonal antibody (Cat # PAB28457) shows moderate nuclear positivity in lymphoid tissue at 1:500-1:1000 dilution.
Applications: IHC-P,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ELK3 polyclonal antibody now

Add to cart