ALX1 polyclonal antibody View larger

ALX1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALX1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ALX1 polyclonal antibody

Brand: Abnova
Reference: PAB28455
Product name: ALX1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ALX1.
Isotype: IgG
Gene id: 8092
Gene name: ALX1
Gene alias: CART1
Gene description: ALX homeobox 1
Immunogen: Recombinant protein corresponding to amino acids of recombinant ALX1.
Immunogen sequence/protein sequence: DNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYP
Protein accession: Q15699
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28455-48-45-1.jpg
Application image note: Immunohistochemical staining of human uterine cervix with ALX1 polyclonal antibody (Cat # PAB28455) shows moderate nuclear positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ALX1 polyclonal antibody now

Add to cart