ATF3 polyclonal antibody View larger

ATF3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATF3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about ATF3 polyclonal antibody

Brand: Abnova
Reference: PAB28450
Product name: ATF3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ATF3.
Isotype: IgG
Gene id: 467
Gene name: ATF3
Gene alias: -
Gene description: activating transcription factor 3
Immunogen: Recombinant protein corresponding to amino acids of recombinant ATF3.
Immunogen sequence/protein sequence: MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC
Protein accession: P18847
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:200-1:500)
Western Blot(1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28450-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with ATF3 polyclonal antibody (Cat # PAB28450) shows strong nuclear positivity in trophoblastic cells at 1:200-1:500 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ATF3 polyclonal antibody now

Add to cart