ATP5B polyclonal antibody View larger

ATP5B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATP5B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,IHC-P,IF

More info about ATP5B polyclonal antibody

Brand: Abnova
Reference: PAB28448
Product name: ATP5B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ATP5B.
Isotype: IgG
Gene id: 506
Gene name: ATP5B
Gene alias: ATPMB|ATPSB|MGC5231
Gene description: ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
Immunogen: Recombinant protein corresponding to amino acids of recombinant ATP5B.
Immunogen sequence/protein sequence: TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD
Protein accession: F8VPV9
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:500-1:1000)
Western Blot(1:250-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28448-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with ATP5B polyclonal antibody (Cat # PAB28448) shows strong cytoplasmic positivity in glandular cells at 1:500-1:1000 dilution.
Applications: WB,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy ATP5B polyclonal antibody now

Add to cart