LBP polyclonal antibody View larger

LBP polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LBP polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about LBP polyclonal antibody

Brand: Abnova
Reference: PAB28447
Product name: LBP polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LBP.
Isotype: IgG
Gene id: 3929
Gene name: LBP
Gene alias: MGC22233
Gene description: lipopolysaccharide binding protein
Immunogen: Recombinant protein corresponding to amino acids of recombinant LBP.
Immunogen sequence/protein sequence: EGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLEALLNYYI
Protein accession: P18428
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:150)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28447-48-36-1.jpg
Application image note: Immunohistochemical staining of human small intestine with LBP polyclonal antibody (Cat # PAB28447) shows moderate cytoplasmic and membranous positivity in glandular cells at 1:150 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy LBP polyclonal antibody now

Add to cart