IL1RN polyclonal antibody View larger

IL1RN polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL1RN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about IL1RN polyclonal antibody

Brand: Abnova
Reference: PAB28441
Product name: IL1RN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant IL1RN.
Isotype: IgG
Gene id: 3557
Gene name: IL1RN
Gene alias: ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430
Gene description: interleukin 1 receptor antagonist
Immunogen: Recombinant protein corresponding to amino acids of recombinant IL1RN.
Immunogen sequence/protein sequence: ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKF
Protein accession: P18510
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:200-1:500)
Western Blot(1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28441-48-35-1.jpg
Application image note: Immunohistochemical staining of human esophagus with IL1RN polyclonal antibody (Cat # PAB28441) shows nuclear and cytoplasmic positivity in squamous epithelial cells.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy IL1RN polyclonal antibody now

Add to cart