Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB,IHC-P |
Brand: | Abnova |
Reference: | PAB28441 |
Product name: | IL1RN polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant IL1RN. |
Isotype: | IgG |
Gene id: | 3557 |
Gene name: | IL1RN |
Gene alias: | ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430 |
Gene description: | interleukin 1 receptor antagonist |
Immunogen: | Recombinant protein corresponding to amino acids of recombinant IL1RN. |
Immunogen sequence/protein sequence: | ETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKF |
Protein accession: | P18510 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry(1:200-1:500) Western Blot(1:200-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human esophagus with IL1RN polyclonal antibody (Cat # PAB28441) shows nuclear and cytoplasmic positivity in squamous epithelial cells. |
Applications: | WB,IHC-P |
Shipping condition: | Dry Ice |