VSIG1 polyclonal antibody View larger

VSIG1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VSIG1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about VSIG1 polyclonal antibody

Brand: Abnova
Reference: PAB28436
Product name: VSIG1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant VSIG1.
Isotype: IgG
Gene id: 340547
Gene name: VSIG1
Gene alias: 1700062D20Rik|GPA34|MGC44287|dJ889N15.1
Gene description: V-set and immunoglobulin domain containing 1
Immunogen: Recombinant protein corresponding to amino acids of recombinant VSIG1.
Immunogen sequence/protein sequence: QAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNNPPDFLGQNQGILNVSVLVKPSKPLCSVQGRPETGHTISLSCLSALGTPSPVYYWHKLEGRDIVPV
Protein accession: C9J4P2
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:500-1:1000)
Western Blot(1:100-1:250)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28436-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with VSIG1 polyclonal antibody (Cat # PAB28436) shows strong membranous and cytoplasmic positivity in glandular cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VSIG1 polyclonal antibody now

Add to cart