Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Rabbit |
Applications | WB,IHC-P,IF |
Brand: | Abnova |
Reference: | PAB28429 |
Product name: | ADA polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant ADA. |
Isotype: | IgG |
Gene id: | 100 |
Gene name: | ADA |
Gene alias: | - |
Gene description: | adenosine deaminase |
Immunogen: | Recombinant protein corresponding to amino acids of recombinant ADA. |
Immunogen sequence/protein sequence: | GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE |
Protein accession: | P00813 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry(1:500-1:1000) Western Blot(1:100-1:250) Immunofluorescence (1-4 ug/ml) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human lymph node with ADA polyclonal antibody (Cat # PAB28429) shows distinct cytoplasmic and nuclear positivity in germinal center cells at 1:500-1:1000 dilution. |
Applications: | WB,IHC-P,IF |
Shipping condition: | Dry Ice |