TXNRD1 polyclonal antibody View larger

TXNRD1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TXNRD1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about TXNRD1 polyclonal antibody

Brand: Abnova
Reference: PAB28426
Product name: TXNRD1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TXNRD1.
Isotype: IgG
Gene id: 7296
Gene name: TXNRD1
Gene alias: GRIM-12|MGC9145|TR|TR1|TRXR1|TXNR
Gene description: thioredoxin reductase 1
Immunogen: Recombinant protein corresponding to amino acids of recombinant TXNRD1.
Immunogen sequence/protein sequence: SCEDGRALEGTLSELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYG
Protein accession: Q16881
Form: Liquid
Recommend dilutions: Immunohistochemistry(1:200-1:500)
Western Blot(1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28426-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with TXNRD1 polyclonal antibody (Cat # PAB28426) shows strong cytoplasmic and nuclear positivity in leydig cells and basal cells in the seminiferous ducts.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy TXNRD1 polyclonal antibody now

Add to cart