FLOT1 polyclonal antibody View larger

FLOT1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLOT1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P

More info about FLOT1 polyclonal antibody

Brand: Abnova
Reference: PAB28424
Product name: FLOT1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FLOT1.
Isotype: IgG
Gene id: 10211
Gene name: FLOT1
Gene alias: -
Gene description: flotillin 1
Immunogen: Recombinant protein corresponding to human FLOT1.
Immunogen sequence/protein sequence: HQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQR
Protein accession: A2AB09
Form: Liquid
Recommend dilutions: Western Blot (Human: 1:250-1:500, Rodent: 1:100-1:500)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28424-48-4-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human stomach with FLOT1 polyclonal antibody (Cat # PAB28424) shows distinct cytoplasmic and membranous positivity with a granular pattern.
Applications: WB,WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy FLOT1 polyclonal antibody now

Add to cart