PCTK1 polyclonal antibody View larger

PCTK1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCTK1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P

More info about PCTK1 polyclonal antibody

Brand: Abnova
Reference: PAB28420
Product name: PCTK1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PCTK1.
Isotype: IgG
Gene id: 5127
Gene name: PCTK1
Gene alias: FLJ16665|PCTAIRE|PCTAIRE1|PCTGAIRE
Gene description: PCTAIRE protein kinase 1
Immunogen: Recombinant protein corresponding to human PCTK1.
Immunogen sequence/protein sequence: MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD
Protein accession: E5RGN0
Form: Liquid
Recommend dilutions: Western Blot (1:100-1:250)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB28420-48-36-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human small intestine with PCTK1 polyclonal antibody (Cat # PAB28420) shows moderate cytoplasmic positivity in glandular cells, with additional strong membranous positivity.
Applications: WB,WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy PCTK1 polyclonal antibody now

Add to cart