APOA4 polyclonal antibody View larger

APOA4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOA4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about APOA4 polyclonal antibody

Brand: Abnova
Reference: PAB28418
Product name: APOA4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant APOA4.
Isotype: IgG
Gene id: 337
Gene name: APOA4
Gene alias: MGC142154|MGC142156
Gene description: apolipoprotein A-IV
Immunogen: Recombinant protein corresponding to human APOA4.
Immunogen sequence/protein sequence: LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP
Protein accession: P06727
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4 °C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB28418-48-I6-1.jpg
Application image note: Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of human duodenum with APOA4 polyclonal antibody (Cat # PAB28418) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy APOA4 polyclonal antibody now

Add to cart